PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00043_0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 959aa    MW: 101891 Da    PI: 7.9751
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00043_0140genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.23.3e-1263106347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT+eEd +l + v  +G+  W++ a+t+   R++kqc++rw+ +
    kfl00043_0140  63 IWTPEEDRKLREHVGAHGTQGWSRFANTLA-DRSGKQCRNRWYHV 106
                      5*****************************.***********976 PP

2Myb_DNA-binding45.71.5e-14113156146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r  WT+eE+++lvd++++ G++ W++ ar +  gR++  +k++w++
    kfl00043_0140 113 REEWTEEEEQILVDLHRRIGKR-WALLARQIK-GRSETAVKNHWNS 156
                      679*******************.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7656107IPR017930Myb domain
SuperFamilySSF466893.0E-2460154IPR009057Homeodomain-like
SMARTSM007171.7E-960109IPR001005SANT/Myb domain
CDDcd001678.96E-1064107No hitNo description
PfamPF139212.8E-1464122No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2064113IPR009057Homeodomain-like
PROSITE profilePS5129420.209108162IPR017930Myb domain
SMARTSM007171.4E-12112160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-15114159IPR009057Homeodomain-like
CDDcd001673.62E-4122157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MQARGGGNQS ASRSTPPEGM MNPNVGPPGT KSAQASKKDE GVGAGVTGGA TVPPAEYKST  60
RTIWTPEEDR KLREHVGAHG TQGWSRFANT LADRSGKQCR NRWYHVLDPE LSREEWTEEE  120
EQILVDLHRR IGKRWALLAR QIKGRSETAV KNHWNSVNRT KNHPPRNARS SVLLNYLLTL  180
QPASPHQQAI SDSTPSASAE EARQSFSAPL PKEPSRSLPG GLVRAESLPL PEGKRKSPPK  240
DITSEGGLGR HVLESPPKRQ KGGEALPRGG NDAPRRHPQP QKSTPLQGTG LAPDEPTEAR  300
DPYLGLLYPG DPFSSGAYPR GLDPQDWARL TGEGARAANL EAEWLLGGLR TGNPSGQSLW  360
GGRTGPEGVL ETALGAAYDG LSEPGEDGAR FRIPDTLFLP RQRHSSRGTA VPRSRGLDPA  420
DLSLQSASGL LAGKADERFS GGWASSLVSG RGERTRQETR APDAPPDKKW PESSGQASQL  480
TLESSPTGVL GGLGGAEFQP PSDEAVTEFL QRWKANFDKW GGEDAPVLGG GRRIPPAQSA  540
ISSNSGTRGE SHVSTLRTEP PELTDTLGSR PVLQQPGRGM APPFNPGLYR SLEVAPRQAM  600
APFPGAQHTP LGNVTWRQNQ ELGGGLFDAS RGGLPTQPRS LAAGLREADL FPRYVESGSD  660
VPEIPRLSTD QLLLLLESYR RLDAVDPPGG LTGVPASFGG SLETGRGEPQ SRRHAEAEQL  720
ATARSLTHLE LTGASNPNPA PDPSAPGGGA RSPRRGGIAR EIQISPNLPM SLAGLPNFPR  780
YGEALAAGRS NQIFPTTLAM TPNISFGEHL SQLASIAPAP NFQYFQSDRP LYRAGHQAPA  840
LPFLTHQGDL SALPGGVYRA LGPDPEARVP AAAFAPADDA GRSALSEQQR VARAMPASSA  900
LWGPSMNLLR DESLPESRSA TSGVATSSEL PPKPSGNEAE NSAGGSVVPD MWDATFLGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-296416130127MYB TRANSFORMING PROTEIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.13e-23myb domain protein 64